PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000040.1_g00038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 389aa    MW: 43296.6 Da    PI: 5.2484
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000040.1_g00038.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.1e-52281551128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yL++k+ gk++++ ++++e+d+yk+ePw+L +  ++k+++ ewyfFs+ d+ky +g+r nrat +gyWk
  Itr_sc000040.1_g00038.1  28 LAPGFRFHPTDEELVRYYLRRKACGKPFRF-QAVSEIDVYKSEPWELAEysSLKNRDLEWYFFSPVDRKYGNGSRLNRATGKGYWK 112
                              579*************************99.88**************84336667777**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v + k++++g+kktLvf++grap+g++t+Wvmheyrl
  Itr_sc000040.1_g00038.1 113 ATGKDRSVRH-KSQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 155
                              **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5724161IPR003441NAC domain
PROSITE profilePS5100552.43728172IPR003441NAC domain
PfamPF023652.5E-2830155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MELQPPQDGA GVVAPPIPKR AVAPPTSLAP GFRFHPTDEE LVRYYLRRKA CGKPFRFQAV  60
SEIDVYKSEP WELAEYSSLK NRDLEWYFFS PVDRKYGNGS RLNRATGKGY WKATGKDRSV  120
RHKSQTIGMK KTLVFHSGRA PDGKRTNWVM HEYRLADEEL VKAGVVQKSG LGPPNGDRYA  180
PFIEEEWDDD TALVIPGGEA EDDAANGDDA HVEGNELDQA AALCKAPQSP VEPQGLPFVC  240
KRERSEDPEP LSLAQAKRSK HDDPSSSNAN GSEDSTTIQE PPTAMMTTTT TTNYSPALLE  300
FPLLGSIEPK ESHPTNVPTF DSSTLEKSVP PGYLKFISNL ENEILNVSME RETLKIEVMR  360
AQAMINILQS RIDLLNKENE DLRRVVRGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-472715719147NAC domain-containing protein 19
3swm_B3e-472715719147NAC domain-containing protein 19
3swm_C3e-472715719147NAC domain-containing protein 19
3swm_D3e-472715719147NAC domain-containing protein 19
3swp_A3e-472715719147NAC domain-containing protein 19
3swp_B3e-472715719147NAC domain-containing protein 19
3swp_C3e-472715719147NAC domain-containing protein 19
3swp_D3e-472715719147NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619467.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLQ8LRM10.0Q8LRM1_PETHY; Nam-like protein 4
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-86NAC domain containing protein 50